Iright
BRAND / VENDOR: Proteintech

Proteintech, 16282-1-AP, GNPNAT1 Polyclonal antibody

CATALOG NUMBER: 16282-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GNPNAT1 (16282-1-AP) by Proteintech is a Polyclonal antibody targeting GNPNAT1 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 16282-1-AP targets GNPNAT1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF-7 cells, mouse large intestine tissue, MDA-MB-231 cells, mouse colon tissue Positive IP detected in: mouse large intestine tissue Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Glucosamine-6 phosphate-N-acetyl Transferase (GNPNAT1) is a key enzyme in the hexosamine biosynthetic pathway. It converts D-glucosamine 6-phosphate to N-acetyl-D-glucosamine 6-phosphate, the acetylation step allowing carbon and nitrogen enter into the hexosamine biosynthetic pathway. Recently inhibition of GNPNAT1 has been reported to promote proliferation and aggressiveness of castration-resistant prostate cancer. (27194471) GNPNAT1 is a small dimeric protein localized in the Golgi and endosome membranes. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9375 Product name: Recombinant human GNPNAT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-184 aa of BC012179 Sequence: MKPDETPMFDPSLLKEVDWSQNTATFSPAISPTHPGEGLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGDYYVTVVEDVTLGQIVATATLIIEHKFIHSCAKRGRVEDVVVSDECRGKQLGKLLLSTLTLLSKKLNCYKITLECLPQNVGFYKKFGYTVSEENYMCRRFLK Predict reactive species Full Name: glucosamine-phosphate N-acetyltransferase 1 Calculated Molecular Weight: 184 aa, 21 kDa Observed Molecular Weight: 21-23 kDa GenBank Accession Number: BC012179 Gene Symbol: GNPNAT1 Gene ID (NCBI): 64841 RRID: AB_2110243 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96EK6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924