Iright
BRAND / VENDOR: Proteintech

Proteintech, 16303-1-AP, HSD17B11 Polyclonal antibody

CATALOG NUMBER: 16303-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HSD17B11 (16303-1-AP) by Proteintech is a Polyclonal antibody targeting HSD17B11 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 16303-1-AP targets HSD17B11 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: L02 cells, mouse heart tissue, mouse liver tissue, mouse lung tissue Positive IHC detected in: human ovary cancer tissue, human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:150-1:600 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9278 Product name: Recombinant human HSD17B11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 33-300 aa of BC021673 Sequence: SVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAAVGFHKTLTDELAALQITGVKTTCLCPNFVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPERFLAVLKRKISVKFDAVIGYKMKAQ Predict reactive species Full Name: hydroxysteroid (17-beta) dehydrogenase 11 Calculated Molecular Weight: 300 aa, 33 kDa Observed Molecular Weight: 28-33 kDa GenBank Accession Number: BC021673 Gene Symbol: HSD17B11 Gene ID (NCBI): 51170 RRID: AB_2878241 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NBQ5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924