Iright
BRAND / VENDOR: Proteintech

Proteintech, 16305-1-AP, GLYATL2 Polyclonal antibody

CATALOG NUMBER: 16305-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GLYATL2 (16305-1-AP) by Proteintech is a Polyclonal antibody targeting GLYATL2 in WB, ELISA applications with reactivity to human, mouse samples 16305-1-AP targets GLYATL2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse lung tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information GLYATL2 is an N-acyltransferase that synthesizes N-acyl glycines, bioactive lipids involved in skin barrier function, sebaceous lipid metabolism, and inflammatory signaling. Expressed in skin, liver, and sebaceous glands, GLYATL2 couples medium/long-chain acyl-CoAs to glycine, contributing to both lipid homeostasis and potential detoxification pathways. Dysregulated GLYATL2 activity affects epidermal health, nociceptive signaling, and has emerging links to cancer biology, making it a noteworthy enzyme in lipid-mediated physiology. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9282 Product name: Recombinant human GLYATL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-294 aa of BC016789 Sequence: MLVLHNSQKLQILYKSLEKSIPESIKVYGAIFNIKDKNPFNMEVLVDAWPDYQIVITRPQKQEMKDDQDHYTNTYHIFTKASDKLEEVLSYSNVISWEQTLQIQGCQEGLDEAIRKVATSKSVQVDYMKTILFIPELPKKHKTSSNDKMELFEVDDDNKKGNFSNMFIDASHAGLVNEHWAFGKNERSLKYIERCLQDFLGFGVLGPEGQLVSWIVMEQSCELRMGYTVPKYRHQGNMLQIGYHLEKYLSQKEIPFYFHVADNNEKSLQALNNLGFKICPCGWHQWKCTPKKYC Predict reactive species Full Name: glycine-N-acyltransferase-like 2 Calculated Molecular Weight: 294 aa, 34 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC016789 Gene Symbol: GLYATL2 Gene ID (NCBI): 219970 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WU03 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924