Proteintech, 16342-1-AP, SLC35A1 Polyclonal antibody

Size: 20ul / 150ul The SLC35A1 (16342-1-AP) by Proteintech is a Polyclonal antibody targeting SLC35A1 in IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 16342-1-AP targets SLC35A1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: mouse spleen tissue, mouse testis tissue, human skin tissue, human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Solute carrier family 35 member A1 (SLC35A1) , also named as CMP-sialic acid transporter (CST) , is responsible for transferring CMP-sialic acid from the cytosol through Golgi membranes, thus playing a vital role in the terminal sialylation of glycan structures. Slc35a1 deficiency causes thrombocytopenia due to impaired megakaryocytopoiesis and excessive platelet clearance in the liver. In addition, SCL35A1 acts independently from sialic acid in functional α-DG O-mannosylation(PMID: 25552652). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9524 Product name: Recombinant human SLC35A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-129 aa of BC017807 Sequence: MAAPRDNVTLLFKLYCLAVMTLMAAVYTIALRYTRTSDKELYFSTTAVCITEVIKLLLSVGILAKETGSLGRFKASLRENVLGSPKELLKLSVPSLVYAVQNNMAFLALSNLDAAVYQVTYQLKIPCTA Predict reactive species Full Name: solute carrier family 35 (CMP-sialic acid transporter), member A1 Calculated Molecular Weight: 337 aa, 37 kDa Observed Molecular Weight: 30-33 kDa GenBank Accession Number: BC017807 Gene Symbol: SLC35A1 Gene ID (NCBI): 10559 RRID: AB_2190077 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P78382 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.