Proteintech, 16348-1-AP, SULT2A1 Polyclonal antibody

Size: 20ul / 150ul The SULT2A1 (16348-1-AP) by Proteintech is a Polyclonal antibody targeting SULT2A1 in WB, IHC, ELISA applications with reactivity to human samples 16348-1-AP targets SULT2A1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, human adrenal gland tissue, human liver tissue, L02 cells Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Specification Tested Reactivity: human Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9542 Product name: Recombinant human SULT2A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-275 aa of BC020755 Sequence: MSDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMA Predict reactive species Full Name: sulfotransferase family, cytosolic, 2A, dehydroepiandrosterone (DHEA)-preferring, member 1 Calculated Molecular Weight: 285 aa, 34 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC020755 Gene Symbol: SULT2A1 Gene ID (NCBI): 6822 RRID: AB_2197770 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q06520 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.