Proteintech, 16357-1-AP, cyclin I Polyclonal antibody

Size: 20ul / 150ul The cyclin I (16357-1-AP) by Proteintech is a Polyclonal antibody targeting cyclin I in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 16357-1-AP targets cyclin I in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, human brain tissue, rat skeletal muscle tissue, mouse skeletal muscle tissue, rat brain tissue Positive IHC detected in: mouse skeletal muscle tissue, human brain tissue, human liver tissue, human lung tissue, human ovary tissue, human placenta tissue, human spleen tissue, human testis tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0493 Product name: Recombinant human CCNI protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 259-377 aa of BC004975 Sequence: VYVYRPLKHTLVTCDKGVFRLHPSSVPGPDFSKDNSKPEVPVRGTAAFYHHLPAASGCKQTSTKRKVEEMEVDDFYDGIKRLYNEDNVSENVGSVCGTDLSRQEGHASPCPPLQPVSVM Predict reactive species Full Name: cyclin I Calculated Molecular Weight: 43 kDa Observed Molecular Weight: 43 kDa GenBank Accession Number: BC004975 Gene Symbol: CCNI Gene ID (NCBI): 10983 RRID: AB_2275606 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14094 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.