Iright
BRAND / VENDOR: Proteintech

Proteintech, 16368-1-AP, FZR1/Cdh1 Polyclonal antibody

CATALOG NUMBER: 16368-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FZR1/Cdh1 (16368-1-AP) by Proteintech is a Polyclonal antibody targeting FZR1/Cdh1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 16368-1-AP targets FZR1/Cdh1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HMy2.CIR cells, C6 cells, HEK-293 cells, HepG2 cells, mouse liver tissue, HeLa cells, NIH/3T3 cells, mouse heart tissue, rat heart tissue, Jurkat cells Positive IP detected in: mouse heart tissue Positive IHC detected in: human liver tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells, HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension Background Information FZR1 gene, also named as FYR, FZR and KIAA1242, has been previously shown to be mutated in lobular breast carcinomas. Direct evidence of FZR1 mutations triggering tumorigenesis has been investigated. FZR1 is a key regulator of ligase activity of the anaphase promoting complex/cyclosome (APC/C) which is playing vital role s in cell cycle progression. There are 7 WD-repeat domains in FZR1. Upon phosphorylation and dephosphorylation, it interacts with other components to modulate cell mitosis. This gene is different to E-cadherin (CDH1)which is an epithelial cell adhesion molecule. It has 55 kDa, 54 kDa and 45 kDa isoforms. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9201 Product name: Recombinant human FZR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 217-342 aa of BC013413 Sequence: SQVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWNAEQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNH Predict reactive species Full Name: fizzy/cell division cycle 20 related 1 (Drosophila) Calculated Molecular Weight: 493 aa, 55 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC013413 Gene Symbol: FZR1 Gene ID (NCBI): 51343 RRID: AB_2107380 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UM11 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924