Proteintech, 16372-1-AP, ALX1 Polyclonal antibody

Size: 20ul / 150ul The ALX1 (16372-1-AP) by Proteintech is a Polyclonal antibody targeting ALX1 in WB, ELISA applications with reactivity to human, mouse, rat samples 16372-1-AP targets ALX1 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse embryo tissue, ROS1728 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9295 Product name: Recombinant human ALX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-326 aa of BC010923 Sequence: MEFLSEKFALKSPPSKNSDFYMGAGGPLEHVMETLDNESFYSKASAGKCVQAFGPLPRAEHHVRLERTSPCQDSSVNYGITKVEGQPLHTELNRAMDNCNSLRMSPVKGMQEKGELDELGDKCDSNVSSSKKRRHRTTFTSLQLEELEKVFQKTHYPDVYVREQLALRTELTEARVQVWFQNRRAKWRKRERYGQIQQAKSHFAATYDISVLPRTDSYPQIQNNLWAGNASGGSVVTSCMLPRDTSSCMTPYSHSPRTDSSYTGFSNHQNQFSHVPLNNFFTDSLLTGATNGHAFETKPEFERRSSSIAVLRMKAKEHTANISWAM Predict reactive species Full Name: ALX homeobox 1 Calculated Molecular Weight: 326 aa, 37 kDa Observed Molecular Weight: 35-37 kDa GenBank Accession Number: BC010923 Gene Symbol: ALX1 Gene ID (NCBI): 8092 RRID: AB_2878249 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15699 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.