Iright
BRAND / VENDOR: Proteintech

Proteintech, 16385-1-AP, TOMM40L Polyclonal antibody

CATALOG NUMBER: 16385-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TOMM40L (16385-1-AP) by Proteintech is a Polyclonal antibody targeting TOMM40L in WB, ELISA applications with reactivity to human samples 16385-1-AP targets TOMM40L in WB, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Caco-2 cells, HEK-293T cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information TOMM40L (Mitochondrial import receptor subunit TOM40B) is a potential channel-forming protein implicated in the import of protein precursors into mitochondria. Specification Tested Reactivity: human Cited Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9401 Product name: Recombinant human TOMM40L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-308 aa of BC014946 Sequence: MGNTLGLAPMGTLPRRSPRREEPLPNPGSFDELHRLCKDVFPAQMEGVKLVVNKVLSSHFQVAHTIHMSALGLPGYHLHAAYAGDWQLSPTEVFPTVVGDMDSSGSLNAQVLLLLAERLRAKAVFQTQQAKFLTWQFDGEYRGDDYTATLTLGNPDLIGESVIMVAHFLQSLTHRLVLGGELVYHRRPGEEGAILTLAGKYSAVHWVATLNVGSGGAHASYYHRANEQVQVGVEFEANTRLQDTTFSFGYHLTLPQANMVFRGLVDSNWCVGAVLEKKMPPLPVTLALGAFLNHWRNRFHCGFSITVG Predict reactive species Full Name: translocase of outer mitochondrial membrane 40 homolog (yeast)-like Calculated Molecular Weight: 308 aa, 34 kDa Observed Molecular Weight: 33-38 kDa GenBank Accession Number: BC014946 Gene Symbol: TOMM40L Gene ID (NCBI): 84134 RRID: AB_3669241 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q969M1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924