Iright
BRAND / VENDOR: Proteintech

Proteintech, 16439-1-AP, ORM1 Polyclonal antibody

CATALOG NUMBER: 16439-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ORM1 (16439-1-AP) by Proteintech is a Polyclonal antibody targeting ORM1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 16439-1-AP targets ORM1 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, mouse bladder tissue Positive IP detected in: human plasma tissue Positive IHC detected in: human liver tissue, human normal colon, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Alpha-1-acid glycoprotein 1 (AGP1), also called orosomucoid-1 (ORM1), is a glycoprotein synthesized mostly by hepatocytes and present in human plasma. ORM1 is an acute-phase reactant protein controlled by glucocorticoids, interleukin-1 and interleukin-6, and increase up to 5-50 times upon infection and/or inflammation. Anti-apoptotic effect and role as immunomodulator of ORM have been reported. ORM is an important carrier for synthetic drugs and influences their distribution and availability in the body. This antibody recognizes a band about 44 kDa in human plasma which may be due to the glycosylation of ORM1 or the dimer formation of the protein. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9758 Product name: Recombinant human ORM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-201 aa of BC026238 Sequence: NLVPVPITNATLDRITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKKDKCEPLEKQHEKERKQEEGES Predict reactive species Full Name: orosomucoid 1 Calculated Molecular Weight: 201 aa, 24 kDa Observed Molecular Weight: 40-47 kDa GenBank Accession Number: BC026238 Gene Symbol: ORM1 Gene ID (NCBI): 5004 RRID: AB_2878259 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P02763 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924