Proteintech, 16461-1-AP, BPNT1 Polyclonal antibody

Size: 20ul / 150ul The BPNT1 (16461-1-AP) by Proteintech is a Polyclonal antibody targeting BPNT1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 16461-1-AP targets BPNT1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, human kidney tissue Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9523 Product name: Recombinant human BPNT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-325 aa of BC017801 Sequence: MASSNTVLMRLVASAYSIAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKADRLAQMSICSSLARKFPKLTIIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYEAGPDAVLGRTIWGVLGLGAFGFQLKEVPAGKHIITTTRSHSNKLVTDCVAAMNPDAVLRVGGVGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNVLQYHKDVSHRTWPKPDFFRAQFFLESHSCFSRNFKNVSTPIKNIYDVIIYAYETDL Predict reactive species Full Name: 3'(2'), 5'-bisphosphate nucleotidase 1 Calculated Molecular Weight: 325 aa, 36 kDa Observed Molecular Weight: 36-40 kDa GenBank Accession Number: BC017801 Gene Symbol: BPNT1 Gene ID (NCBI): 10380 RRID: AB_2067193 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95861 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.