Iright
BRAND / VENDOR: Proteintech

Proteintech, 16462-1-AP, XPA Polyclonal antibody

CATALOG NUMBER: 16462-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The XPA (16462-1-AP) by Proteintech is a Polyclonal antibody targeting XPA in WB, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse samples 16462-1-AP targets XPA in WB, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: L02 cells, HeLa cells, MCF-7 cells Positive IP detected in: L02 cells Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information XPA, also named as DNA repair protein complementing XP-A cells, is a 272 amino acid protein, which belongs to the XPA family. XPA is expressed in various cell lines and in skin fibroblasts. XPA is involved in DNA excision repair. Initiates repair by binding to damaged sites with various affinities, depending on the photoproduct and the transcriptional state of the region. XPA is required for UV-induced CHEK1 phosphorylation and the recruitment of CEP164 to cyclobutane pyrimidine dimmers (CPD), sites of DNA damage after UV irradiation. The calculated molecular weight of XPA is 31 kDa, but modified XPA protein is about 40 kDa (PMID: 17848622). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9536 Product name: Recombinant human XPA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-273 aa of BC014965 Sequence: MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMANVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETIVHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM Predict reactive species Full Name: xeroderma pigmentosum, complementation group A Calculated Molecular Weight: 374aa,42 kDa; 273aa,31 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC014965 Gene Symbol: XPA Gene ID (NCBI): 7507 RRID: AB_2878261 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P23025 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924