Iright
BRAND / VENDOR: Proteintech

Proteintech, 16481-1-AP, PHAX Polyclonal antibody

CATALOG NUMBER: 16481-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PHAX (16481-1-AP) by Proteintech is a Polyclonal antibody targeting PHAX in WB, IF/ICC, ELISA applications with reactivity to human samples 16481-1-AP targets PHAX in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Small nuclear and small nucleolar RNAs (snRNAs and snoRNAs) are essential components of snRNPs and snoRNPs, and have a critical role in the maturation of, respectively, mRNAs and rRNAs within the nucleus of eukaryotic cells. Complex and specific pathways exist for the assembly of snRNPs and snoRNPs, involving, nucleocytoplasmic transport of snRNAs and intranuclear transport between compartments of snoRNAs. In metazoa, a subset of spliceosomal snRNAs are exported from the nucleus after transcription. This export occurs in a large complex containing a snRNA, the nuclear cap binding complex (CBC), RanGTP, the leucine-rich nuclear export signal receptor CRM1/Xpo1, and the recently identified phosphoprotein PHAX (phosphorylated adaptor for RNA export). PHAX contains a conserved single-stranded nucleic acid binding domain (RNA_GG_bind domain) with no sequence homology with any other known RNA-binding module [PMID:15574332,11333016, 15574332] Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9602 Product name: Recombinant human PHAX protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-394 aa of BC021161 Sequence: MALEVGDMEDGQLSDSDSDMTVAPSDRPLQLPKVLGGDSAMRAFQNTATACAPVSHYRAVESVDSSEESFSDSDDDSCLWKRKRQKCFNPPPKPEPFQFGQSSQKPPVAGGKKINNIWGAVLQEQNQDAVATELGILGMEGTIDRSRQSETYNYLLAKKLRKESQEHTKDLDKELDEYMHGGKKMGSKEEENGQGHLKRKRPVKDRLGNRPEMNYKGRYEITAEDSQEKVADEISFRLQEPKKDLIARVVRIIGNKKAIELLMETAEVEQNGGLFIMNGSRRRTPGGVFLNLLKNTPSISEEQIKDIFYIENQKEYENKKAARKRRTQVLGKKMKQAIKSLNFQEDDDTSRETFASDTNEALASLDESQEGHAEAKLEAEEAIEVDHSHDLDIF Predict reactive species Full Name: phosphorylated adaptor for RNA export Calculated Molecular Weight: 394 aa, 44 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC021161 Gene Symbol: PHAX Gene ID (NCBI): 51808 RRID: AB_2299663 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H814 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924