Iright
BRAND / VENDOR: Proteintech

Proteintech, 16487-1-AP, RPL26L1 Polyclonal antibody

CATALOG NUMBER: 16487-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RPL26L1 (16487-1-AP) by Proteintech is a Polyclonal antibody targeting RPL26L1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 16487-1-AP targets RPL26L1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, K-562 cells, MCF-7 cells Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information RPL26L1, also named as RPL26P1, belongs to the universal ribosomal protein uL24 family. RPL26L1 shares high sequence similarity with ribosomal protein L26 and plays a role in protein synthesis (PMID: 31673979). The molecular mass of RPL26L1 is 17 kDa. Studies have shown that RPL26L1 is related to autism spectrum disorder and is one of the potential biomarkers of the neurodegenerative disease Friedreich's ataxia. In addition, RPL26L1 may be closely related with SLE development (PMID: 31889427). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9609 Product name: Recombinant human RPL26L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-145 aa of BC017360 Sequence: MKFNPFVTSDRSKNRKRHFNAPSHVRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVITRLKLDKDRKKILERKAKSRQVGKEKGKYKEELIEKMQE Predict reactive species Full Name: ribosomal protein L26-like 1 Calculated Molecular Weight: 145 aa, 17 kDa Observed Molecular Weight: 22-25 kDa GenBank Accession Number: BC017360 Gene Symbol: RPL26L1 Gene ID (NCBI): 51121 RRID: AB_2181740 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UNX3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924