Iright
BRAND / VENDOR: Proteintech

Proteintech, 16518-1-AP, RNASEH2C Polyclonal antibody

CATALOG NUMBER: 16518-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RNASEH2C (16518-1-AP) by Proteintech is a Polyclonal antibody targeting RNASEH2C in WB, IP, IHC, ELISA applications with reactivity to human samples 16518-1-AP targets RNASEH2C in WB, IHC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HEK-293 cells, human spleen tissue, human testis tissue, HeLa cells, Jurkat cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human brain tissue, human lung tissue, human skin tissue, human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9739 Product name: Recombinant human RNASEH2C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-164 aa of BC023588 Sequence: MESGDEAAIERHRVHLRSATLRDAVPATLHLLPCEVAVDGPAPVGRFFTPAIRQGPEGLEVSFRGRCLRGEEVAVPPGLVGYVMVTEEKKVSMGKPDPLRDSGTDDQEEEPLERDFDRFIGATANFSRFTLWGLETIPGPDAKVRGALTWPSLAAAIHAQVPED Predict reactive species Full Name: ribonuclease H2, subunit C Calculated Molecular Weight: 164 aa, 18 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC023588 Gene Symbol: RNASEH2C Gene ID (NCBI): 84153 RRID: AB_2181648 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TDP1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924