Proteintech, 16527-1-AP, METTL6 Polyclonal antibody

Size: 20ul / 150ul The METTL6 (16527-1-AP) by Proteintech is a Polyclonal antibody targeting METTL6 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 16527-1-AP targets METTL6 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, MCF-7 cells Positive IP detected in: MCF-7 cells Positive IHC detected in: human lung cancer tissue, human breast cancer tissue, human placenta tissue, human skin tissue, human brain tissue, human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Methyltransferase-like protein 6 (METTL6) belongs to the METL family. METTL6 is as a crucial regulator of tumor cell growth, and METTL6 is a bona fide transfer RNA (tRNA) methyltransferase, catalyzing the formation of 3-methylcytidine at C32 of specific serine tRNA isoacceptors (PMID:32923617). METTL6 is a member of the RNA methyltransferase family that has been identified in many cancers. The mRNA expression levels of METTL6 were significantly upregulated in HCC tumor tissues compared to that in adjacent non tumor tissues. CRISPR/Cas9 mediated knockout of METTL6 in hepatocellular carcinoma cell lines remarkably inhibited colony formation, cell proliferation, cell migration, cell invasion and cell attachment ability (PMID:34913069). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9768 Product name: Recombinant human METTL6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-250 aa of BC022400 Sequence: MASLQRKGLQARILTSEEEEKLKRDQTLVSDFKQQKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEELRSCREFEDQKLTMLEAGCGVGNCLFPLLEEDPNIFAYACDFSPRAIEYVKQNPLYDTERCKVFQCDLTKDDLLDHVPPESVDVVMLIFVLSAVHPDKMHLVLQNIYKVLKPGKSVLFRDYGLYDHAMLRFKASSKLGENFYVRQDGTRSYFFTDDFLAQLFMDTGYEEVVNEYVFRETVN Predict reactive species Full Name: methyltransferase like 6 Calculated Molecular Weight: 255 aa, 30 kDa Observed Molecular Weight: 30-32 kDa GenBank Accession Number: BC022400 Gene Symbol: METTL6 Gene ID (NCBI): 131965 RRID: AB_2142190 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TCB7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.