Proteintech, 16537-1-AP, DYNLRB2 Polyclonal antibody

Size: 20ul / 150ul The DYNLRB2 (16537-1-AP) by Proteintech is a Polyclonal antibody targeting DYNLRB2 in WB, ELISA applications with reactivity to human, mouse, rat samples 16537-1-AP targets DYNLRB2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information DYNLRB2(Dynein light chain roadblock-type-2) also known as DNCL2B, DNLC2B, belongs to the GAMAD family. DYNLRB2 is a male meiosis-upregulated dynein light chain that is indispensable for spindle formation in meiosis I (PMID: 36973253). DYNLRB2 expression is significantly down-regulated in hepatocellular carcinoma (HCC) patients (PMID: 11750132). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9842 Product name: Recombinant human DYNLRB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-54 aa of BC054892 Sequence: MAEVEETLKRIQSHKGVIGTMVVNAEDPRFVTFKYARQLTAFQRKSGQQITIKD Predict reactive species Full Name: dynein, light chain, roadblock-type 2 Calculated Molecular Weight: 54 aa, 6 kDa Observed Molecular Weight: 11 kDa GenBank Accession Number: BC054892 Gene Symbol: DYNLRB2 Gene ID (NCBI): 83657 RRID: AB_3669248 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TF09 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.