Proteintech, 16564-1-AP, TMEM11 Polyclonal antibody

Size: 20ul / 150ul The TMEM11 (16564-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM11 in WB, ELISA applications with reactivity to human, mouse, rat samples 16564-1-AP targets TMEM11 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human placenta tissue, mouse placenta tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information TMEM11, also named as C17orf35 and PM1, belongs to the TMEM11 family. TMEM11 is a mitochondrial inner-membrane protein facing the matrix. It regulates mitochondrial morphogenesis independently of the DRP1/MFN fission/fusion pathways.(PMID:21274005) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9839 Product name: Recombinant human TMEM11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-175 aa of BC020815 Sequence: MAAWGRRRLGPGSSGGSARERVSLSATDCYIVHEIYNGENAQDQFEYELEQALEAQYKYIVIEPTRIGDETARWITVGNCLHKTAVLAGTACLFTPLALPLDYSHYISLPAGVLSLACCTLYGISWQFDPCCKYQVEYDAYKLSRLPLHTLTSSTPVVLVRKDDLHRKRLHNTIA Predict reactive species Full Name: transmembrane protein 11 Calculated Molecular Weight: 192 aa, 22 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC020815 Gene Symbol: TMEM11 Gene ID (NCBI): 8834 RRID: AB_2287468 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P17152 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.