Proteintech, 16575-1-AP, PTOV1 Polyclonal antibody

Size: 20ul / 150ul The PTOV1 (16575-1-AP) by Proteintech is a Polyclonal antibody targeting PTOV1 in WB, ELISA applications with reactivity to human, mouse, rat samples 16575-1-AP targets PTOV1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information PTOV1 is a dual-domain adaptor and transcriptional co-regulator that promotes cell proliferation and oncogenic signaling through interactions with E2F1, RSK, and Mediator components. Shuttling between cytoplasm and nucleus, it integrates growth factor and differentiation pathways to balance proliferation and differentiation. Overexpressed in multiple cancers-most prominently prostate carcinoma-PTOV1 is linked to tumor progression, therapy resistance, and poor prognosis, positioning it as a potential biomarker and therapeutic target in epithelial malignancies. (PMID: 15713644) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9859 Product name: Recombinant human PTOV1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 57-416 aa of BC042921 Sequence: MEGARVFGALGPIGPSSPGLTLGGLAVSEHRLSNKLLAWSGVLEWQEKRRPYSDSTAKLKRTLPCQAYVNQGENLETDQWPQKLIMQLIPQQLLTTLGPLFRNSQLAQFHFTNRDCDSLKGLCRIMGNGFAGCMLFPHISPCEVRVLMLLYSSKKKIFMGLIPYDQSGFVSAIRQVITTRKQAVGPGGVNSGPVQIVNNKFLAWSGVMEWQEPRPEPNSRSKRWLPSHVYVNQGEILRTEQWPRKLYMQLIPQQLLTTLVPLFRNSRLVQFHFTKDLETLKSLCRIMDNGFAGCVHFSYKASCEIRVLMLLYSSEKKIFIGLIPHDQGNFVNGIRRVIANQQQVLQRNLEQEQQQRGMGG Predict reactive species Full Name: prostate tumor overexpressed 1 Calculated Molecular Weight: 416 aa, 47 kDa Observed Molecular Weight: 58 kDa GenBank Accession Number: BC042921 Gene Symbol: PTOV1 Gene ID (NCBI): 53635 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86YD1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.