Proteintech, 16577-1-AP, NT5C Polyclonal antibody

Size: 20ul / 150ul The NT5C (16577-1-AP) by Proteintech is a Polyclonal antibody targeting NT5C in IHC, ELISA applications with reactivity to human, mouse, rat samples 16577-1-AP targets NT5C in IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: mouse skeletal muscle tissue, human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information NT5C, also named as DNT1 and UMPH2, has two isoforms with calculated MW 23 kDa and 13 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9862 Product name: Recombinant human NT5C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-201 aa of BC017454 Sequence: MARSVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIPGALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVLGDLLIDDKDTVRGQEETPSWEHILFTCCHNRHLVLPPTRRRLLSWSDNWREILDSKRGAAQRE Predict reactive species Full Name: 5', 3'-nucleotidase, cytosolic Calculated Molecular Weight: 201 aa, 23 kDa GenBank Accession Number: BC017454 Gene Symbol: NT5C Gene ID (NCBI): 30833 RRID: AB_2153940 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TCD5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.