Iright
BRAND / VENDOR: Proteintech

Proteintech, 16590-1-AP, MED31 Polyclonal antibody

CATALOG NUMBER: 16590-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MED31 (16590-1-AP) by Proteintech is a Polyclonal antibody targeting MED31 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 16590-1-AP targets MED31 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, human brain tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information MED31, also named as SOH1 or CGI-125, is a 131 amino acid protein, which belongs to the Mediator complex subunit 31 family. MED31 localizes in the nucleus. MED31 as a component of the Mediator complex, a coactivator is involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. MED31 functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9008 Product name: Recombinant human MED31 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-131 aa of BC012539 Sequence: MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKDPEYAKYLKYPQCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQNNTSGK Predict reactive species Full Name: mediator complex subunit 31 Calculated Molecular Weight: 131 aa, 16 kDa Observed Molecular Weight: 16 kDa GenBank Accession Number: BC012539 Gene Symbol: MED31 Gene ID (NCBI): 51003 RRID: AB_2142447 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y3C7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924