Iright
BRAND / VENDOR: Proteintech

Proteintech, 16591-1-AP, ACSM5 Polyclonal antibody

CATALOG NUMBER: 16591-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ACSM5 (16591-1-AP) by Proteintech is a Polyclonal antibody targeting ACSM5 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 16591-1-AP targets ACSM5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue Positive IHC detected in: human liver cancer tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information ACSM5(Acyl-CoA synthetase medium-chain family member 5) is also named as MACS3 and belongs to the ATP-dependent AMP-binding enzyme family. ACSM5 has medium-chain fatty acid:CoA ligase activity with broad substrate specificity (in vitro). This protein has 2 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9373 Product name: Recombinant human ACSM5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-208 aa of BC016703 Sequence: MRPWLRHLVLQALRNSRAFCGSHGKPAPLPVPQKIVATWEAISLGRQLVPEYFNFAHDVLDVWSRLEEAGHRPPNPAFWWVNGTGAEIKWSFEELGKQSRKAANVLGGACGLQPGDRMMLVLPRLPEWWLVSVACMRTGTVVIPGVTQLTEKDLKYRLQASRAKSIITSDSLAPRVDAISAECPSLQTKLLVSDSSRPGWLNFRELLR Predict reactive species Full Name: acyl-CoA synthetase medium-chain family member 5 Calculated Molecular Weight: 208 aa, 23 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: BC016703 Gene Symbol: ACSM5 Gene ID (NCBI): 54988 RRID: AB_2878284 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6NUN0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924