Proteintech, 16632-1-AP, HDDC2 Polyclonal antibody

Size: 20ul / 150ul The HDDC2 (16632-1-AP) by Proteintech is a Polyclonal antibody targeting HDDC2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 16632-1-AP targets HDDC2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, K-562 cells, MCF-7 cells, PC-3 cells, mouse testis tissue, rat testis tissue Positive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information HDDC2, also named as C6orf74, plays a role in the maintenance of pluripotency in human ES and iPS cells. HDDC2 is a nuclear‐encoded but mitochondrially localized protein. It has been reported as associated with oxidative metabolism. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9971 Product name: Recombinant human HDDC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 15-218 aa of BC003357 Sequence: MASVSSATFSGHGARSLLQFLRLVGQLKRVPRTGWVYRNVQRPESVSDHMYRMAVMAMVIKDDRLNKDRCVRLALVHDMAECIVGDIAPADNIPKEEKHRREEEAMKQITQLLPEDLRKELYELWEEYETQSSAEAKFVKQLDQCEMILQASEYEDLEHKPGRLQDFYDSTAGKFNHPEIVQLVSELEAERSTNIAAAASEPHS Predict reactive species Full Name: HD domain containing 2 Calculated Molecular Weight: 23 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC003357 Gene Symbol: HDDC2 Gene ID (NCBI): 51020 RRID: AB_10597248 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7Z4H3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.