Proteintech, 16640-1-AP, NDUFA5 Polyclonal antibody

Size: 20ul / 150ul The NDUFA5 (16640-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFA5 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 16640-1-AP targets NDUFA5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse brain tissue, rat brain tissue, Jurkat cells, mouse liver tissue Positive IHC detected in: mouse cerebellum tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information NDUFA5, also named as CI-13kD-B and NDUA5, belongs to the complex I NDUFA5 subunit family. It is accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which functions in the transfer of electrons from NADH to the respiratory chain. NDUFA5,an enrichment of mitochondrial protein, can be used as a mitochondrial marker protein(PMID:21360670). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9995 Product name: Recombinant human NDUFA5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-116 aa of BC000813 Sequence: MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI Predict reactive species Full Name: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5, 13kDa Calculated Molecular Weight: 13 kDa Observed Molecular Weight: 13 kDa GenBank Accession Number: BC000813 Gene Symbol: NDUFA5 Gene ID (NCBI): 4698 RRID: AB_2251270 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16718 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.