Iright
BRAND / VENDOR: Proteintech

Proteintech, 16677-1-AP, CD244 Polyclonal antibody

CATALOG NUMBER: 16677-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CD244 (16677-1-AP) by Proteintech is a Polyclonal antibody targeting CD244 in WB, ELISA applications with reactivity to human samples 16677-1-AP targets CD244 in WB, IF, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: NK-92 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information CD244, also known as SLAMF4 or 2B4, is a type I transmembrane glycoprotein belonging to the signaling lymphocyte activation molecule (SLAM) family. It consists of an extracellular segment with two immunoglobulin (Ig)-like domains, a transmembrane region, and a cytoplasmic domain containing tyrosine-based motifs (PMID: 9841922; 30546369). CD244 is present on natural killer (NK) cells, γδ T cells, a subset of CD8+ T cells, monocytes, basophils, dendritic cells, and myeloid-derived suppressor cells (MDSCs) (PMID: 30546369). It binds to CD48 with high affinity and transmits stimulatory or inhibitory signals that regulate immune function (PMID: 9841922; 18523281). Specification Tested Reactivity: human Cited Reactivity: human, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9860 Product name: Recombinant human CD244 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-220 aa of BC053985 Sequence: GCQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEF Predict reactive species Full Name: CD244 molecule, natural killer cell receptor 2B4 Calculated Molecular Weight: 365 aa, 41 kDa Observed Molecular Weight: 60-70 kDa GenBank Accession Number: BC053985 Gene Symbol: CD244 Gene ID (NCBI): 51744 RRID: AB_2878297 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BZW8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924