Iright
BRAND / VENDOR: Proteintech

Proteintech, 16692-1-AP, PARP11 Polyclonal antibody

CATALOG NUMBER: 16692-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PARP11 (16692-1-AP) by Proteintech is a Polyclonal antibody targeting PARP11 in WB, ELISA applications with reactivity to human, mouse samples 16692-1-AP targets PARP11 in WB, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293T cells, IFN beta treated HEK-293T cells, PC-3 cells, mouse heart tissue, mouse spleen tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information PARP11, also named as ARTD11, belongs to the  ARTD/PARP family. PARP11 is a mono-ADP-ribosyltransferase that mediates mono-ADP-ribosylation of target proteins. PARP11 plays a role in nuclear envelope stability and nuclear remodeling during spermiogenesis (PMID: 25043379). PARP11 has 4 isoforms with the molecular mass of 28-40 kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: human, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10053 Product name: Recombinant human PARP11 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-331 aa of BC017569 Sequence: MFHKAEELFSKTTNNEVDDMDTSDTQWGWFYLAECGKWHMFQPDTNSQCSVSSEDIEKSFKTNPCGSISFTTSKFSYKIDFAEMKQMNLTTGKQRLIKRAPFSISAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTMDRNRIKRIQRIQNLDLWEFFCRKKAQLKKKRGVPQINEQMLFHGTSSEFVEAICIHNFDWRINGIHGAVFGKGTYFARDAAYSSRFCKDDIKHGNTFQIHGVSLQQRHLFRTYKSMFLARVLIGDYINGDSKYMRPPSKDGSYVNLYDSCVDDTWNPKIFVVFDANQIYPEYLIDFH Predict reactive species Full Name: poly (ADP-ribose) polymerase family, member 11 Calculated Molecular Weight: 331 aa, 39 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC017569 Gene Symbol: PARP11 Gene ID (NCBI): 57097 RRID: AB_2158504 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NR21 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924