Proteintech, 16697-1-AP, ARHGAP4 Polyclonal antibody

Size: 20ul / 150ul The ARHGAP4 (16697-1-AP) by Proteintech is a Polyclonal antibody targeting ARHGAP4 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 16697-1-AP targets ARHGAP4 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HL-60 cells, Jurkat cells, K-562 cells, human placenta tissue, mouse spleen tissue Positive IP detected in: HL-60 cells Positive IHC detected in: human lymphoma tissue, mouse ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10091 Product name: Recombinant human ARHGAP4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 714-986 aa of BC052303 Sequence: VALQGRVNQLVQTLIVQPDRVFPPLTSLPGPVYEKCMAPPSASCLGDAQLESLGADNEPELEAEMPAQEDDLEGVVEAVACFAYTGRTAQELSFRRGDVLRLHERASSDWWRGEHNGMRGLIPHKYITLPAGTEKQVVGAGLQTAGESGSSPEGLLASELVHRPEPCTSPEAMGPSGHRRRCLVPASPEQHVEVDKAVAQNMDSVFKELLGKTSVRQGLGPASTTSPSPGPRSPKAPPSSRLGRNKGFSRGPGAPASPSASHPQGLDTTPKPH Predict reactive species Full Name: Rho GTPase activating protein 4 Calculated Molecular Weight: 986 aa, 109 kDa Observed Molecular Weight: 115 kDa GenBank Accession Number: BC052303 Gene Symbol: ARHGAP4 Gene ID (NCBI): 393 RRID: AB_1850892 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P98171 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.