Proteintech, 16708-1-AP, HSPC159 Polyclonal antibody

Size: 20ul / 150ul The HSPC159 (16708-1-AP) by Proteintech is a Polyclonal antibody targeting HSPC159 in WB, ELISA applications with reactivity to human, mouse, rat, pig samples 16708-1-AP targets HSPC159 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: mouse brain tissue, pig brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information HSPC159 is a novel human galectin‐related protein (also known as GRP) that is mapped to human chromosome 2p13. The HSPC159 gene was originally deduced by partial sequence alignment and confirmed by a full‐length sequence for an mRNA isolated from CD34+ hematopoietic stem cells. Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10109 Product name: Recombinant human HSPC159 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-172 aa of BC062691 Sequence: MAGSVADSDAVVKLDDGHLNNSLSSPVQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIVDLNPESFAISLTCGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQPFRVEILCEHPRFRVFVDGHQLFDFYHRIQTLSAIDTIKINGDLQITKLG Predict reactive species Full Name: galectin-related protein Calculated Molecular Weight: 172 aa, 19 kDa Observed Molecular Weight: 20 kDa, 27 kDa GenBank Accession Number: BC062691 Gene Symbol: HSPC159 Gene ID (NCBI): 29094 RRID: AB_3085506 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q3ZCW2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.