Iright
BRAND / VENDOR: Proteintech

Proteintech, 16742-1-AP, ACAD8 Polyclonal antibody

CATALOG NUMBER: 16742-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ACAD8 (16742-1-AP) by Proteintech is a Polyclonal antibody targeting ACAD8 in WB, ELISA applications with reactivity to human, mouse, rat samples 16742-1-AP targets ACAD8 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse pancreas tissue, mouse lung tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information The acyl-CoA dehydrogenases (ACAD) (EC 1.3.99) are a family of nuclear-encoded mitochondrial enzymes involved in the metabolism of fatty acids and branched chain amino acids (PMID: 13295225). The eighth member of this family, ACAD8, catalyzes the conversion of isobutyryl-CoA to methacrylyl-CoA in valine catabolism (PMID: 12359132). ACAD8, also named as acyl-Coenzyme A dehydrogenase family, member 8, has 3 isoform which molecular weight is 45, 31 and 38 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9967 Product name: Recombinant human ACAD8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-415 aa of BC001964 Sequence: MLWSGCRRFGARLGCLPGGLRVLVQTGHRSLTSCIDPSMGLNEEQKEFQKVAFDFAAREMAPNMAEWDQKELFPVDVMRKAAQLGFGGVYIQTDVGGSGLSRLDTSVIFEALATGCTSTTAYISIHNMCAWMIDSFGNEEQRHKFCPPLCTMEKFASYCLTEPGSGSDAASLLTSAKKQGDHYILNGSKAFISGAGESDIYVVMCRTGGLGPKGISCIVVEKGTPGLSFGKKEKKVGWNSQPTRAVIFEDCAVPVANRIGSEGQGFLIAVRGLNGGRINIASCSLGAAHASVILTRDHLNVRKQFGEPLASNQYLQFTLADMATRLVAARLMVRNAAVALQEERKDAVALCSMAKLFATDECFAICNQALQMHGGYGYLKDYAVQQYVRDSRVHQILEGSNEVMRILISRSLLQE Predict reactive species Full Name: acyl-Coenzyme A dehydrogenase family, member 8 Calculated Molecular Weight: 45 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC001964 Gene Symbol: ACAD8 Gene ID (NCBI): 27034 RRID: AB_2219559 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UKU7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924