Iright
BRAND / VENDOR: Proteintech

Proteintech, 16747-1-AP, Fibrinogen Beta Chain Polyclonal antibody

CATALOG NUMBER: 16747-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Fibrinogen Beta Chain (16747-1-AP) by Proteintech is a Polyclonal antibody targeting Fibrinogen Beta Chain in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 16747-1-AP targets Fibrinogen Beta Chain in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, mouse kidney tissue, mouse brain tissue, mouse liver tissue Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Fibrinogen is a soluble plasma glycoprotein synthesized in the liver. It is composed of two sets of three structurally different subunits: alpha (FGA), beta (FGB), gamma (FGG). Fibrinogen is converted by thrombin into fibrin during blood coagulation. Fibrinogen and fibrin play overlapping roles in blood clotting, fibrinolysis, cellular and matrix interactions, the inflammatory response, wound healing, and neoplasia (PMID: 16102057). FGB is the beta chain of fibrinogen. During conversion of fibrinogen to fibrin, fibrinopeptide B is cleaved from FGB by thrombin. Mutations in the gene of FGB lead to several disorders, including afibrinogenemia, dysfibrinogenemia, hypodysfibrinogenemia and thrombotic tendency. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, plasmodium falciparum Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10169 Product name: Recombinant human FGB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 142-491 aa of BC107766 Sequence: SSSFQYMYLLKDLWQKRQKQVKDNENVVNEYSSELEKHQLYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEITRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFFPQQ Predict reactive species Full Name: fibrinogen beta chain Calculated Molecular Weight: 491 aa, 56 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC107766 Gene Symbol: Fibrinogen Beta Chain Gene ID (NCBI): 2244 RRID: AB_11042764 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P02675 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924