Iright
BRAND / VENDOR: Proteintech

Proteintech, 16789-1-AP, HLA-DRB3 Polyclonal antibody

CATALOG NUMBER: 16789-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HLA-DRB3 (16789-1-AP) by Proteintech is a Polyclonal antibody targeting HLA-DRB3 in WB, IF/ICC, ELISA applications with reactivity to human samples 16789-1-AP targets HLA-DRB3 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Daudi cells, Raji cells, Ramos cells Positive IF/ICC detected in: Raji cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Human major histocompatibility complex (MHC) antigens, also referred to as human leukocyte antigens (HLA), are encoded by genes located on the short arm of chromosome 6 (6p21.3). There are two classes of HLA antigens: class I (HLA-A, B and C) and class II (HLA-D). The class II molecules are heterodimers consisting of an alpha (DRA) and a beta (DRB) chain. HLA-DRB3 is a beta chain of MHC class II molecule expressed on the surface of antigen presenting cells (APC) like B cells, macrophages, and dendritic cells (PMID: 30192820). It is involved in adaptive immune responses by presenting peptide antigens to CD4+ T cells (PMID: 19830726). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10223 Product name: Recombinant human HLA-DRB3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 31-228 aa of BC008987 Sequence: DTRPRFLELRKSECHFFNGTERVRYLDRYFHNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSALTVEWRARSESAQSKM Predict reactive species Full Name: major histocompatibility complex, class II, DR beta 3 Calculated Molecular Weight: 266 aa, 30 kDa Observed Molecular Weight: 28-30 kDa GenBank Accession Number: BC008987 Gene Symbol: HLA-DRB3 Gene ID (NCBI): 3125 RRID: AB_3085508 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P79483 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924