Iright
BRAND / VENDOR: Proteintech

Proteintech, 16794-1-AP, PRKRIP1 Polyclonal antibody

CATALOG NUMBER: 16794-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PRKRIP1 (16794-1-AP) by Proteintech is a Polyclonal antibody targeting PRKRIP1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 16794-1-AP targets PRKRIP1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: NIH/3T3 cells, L02 cells Positive IP detected in: NIH/3T3 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Caco-2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information PRKR-interacting protein 1 (PRKRIP1), a component of the splicing C complex, is a double-stranded RNA-binding protein. PRKRIP1 consists of a fully extended N-terminal loop (residues 51-75) and an 18-turn α helix (residues 76-142) that spans 100 Å (PMID: 28502770). The full-length cDNA contains an open reading frame of 561 bp, which encodes an 184-amino acid polypeptide with a predicted molecular mass of 21 kDa (PMID: 12679338). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10266 Product name: Recombinant human PRKRIP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-184 aa of BC014298 Sequence: MASPAASSVRPPRPKKEPQTLVIPKNAAEEQKLKLERLMKNPDKAVPIPEKMSEWAPRPPPEFVRDVMGSSAGAGSGEFHVYRHLRRREYQRQDYMDAMAEKQKLYAEFQKRLEKNKIAAEEQTAKRRKKRQKLKEKKLLAKKMKLEQKKQEGPGQPKEQGSSSSAEASGTEEEEEVPSFTMGR Predict reactive species Full Name: PRKR interacting protein 1 (IL11 inducible) Calculated Molecular Weight: 184 aa, 21 kDa Observed Molecular Weight: 21-25 kDa GenBank Accession Number: BC014298 Gene Symbol: PRKRIP1 Gene ID (NCBI): 79706 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H875 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924