Product Description
Size: 20ul / 150ul
The DYNLL2 (16811-1-AP) by Proteintech is a Polyclonal antibody targeting DYNLL2 in WB, ELISA applications with reactivity to human, mouse, rat samples
16811-1-AP targets DYNLL2 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: A431 cells, human heart tissue, mouse brain tissue, rat brain tisssue
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag10345 Product name: Recombinant human DYNLL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-89 aa of BC010744 Sequence: MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG Predict reactive species
Full Name: dynein, light chain, LC8-type 2
Calculated Molecular Weight: 89 aa, 10 kDa
Observed Molecular Weight: 10 kDa
GenBank Accession Number: BC010744
Gene Symbol: DYNLL2
Gene ID (NCBI): 140735
RRID: AB_2093667
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q96FJ2
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924