Iright
BRAND / VENDOR: Proteintech

Proteintech, 16816-1-AP, CC2D1A Polyclonal antibody

CATALOG NUMBER: 16816-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CC2D1A (16816-1-AP) by Proteintech is a Polyclonal antibody targeting CC2D1A in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 16816-1-AP targets CC2D1A in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, Jurkat cells, mouse liver tissue Positive IP detected in: mouse liver tissue Positive IHC detected in: human testis tissue, human brain tissue, human liver tissue, human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information CC2D1A (coiled-coil and C2 domain-containing 1A), also known as Freud-1, Aki1 or TAPE (TBK1-associated protein in endolysosomes), is a evolutionary conserved protein located in different subcellular compartments, including the nucleus, centrosome, and endolysosomes. It acts as a scaffold protein that interacts with various proteins and plays diverse biological roles. Mutations in CC2D1A have been linked to nonsyndromic mental retardation (NMSR) and generate a truncated 85-kDa product. Several isoforms of CC2D1A proteins have also been described: 120 /130-kDa doublet of long isoform and 67 kDa short isoform. The short isoform of CC2D1A has been identified as the predominant isoform in rodent cells, while the long isoform is more abundant in human cells. Recently it has been reported that CC2D1A/TAPE is the first innate immune regulator implicated in both TLR and RLR signaling at a very early step. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10355 Product name: Recombinant human CC2D1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC064981 Sequence: MHKRKGPPGPPGRGAAAARQLGLLVDLSPDGLMIPEDGANDEELEAEFLALVGGQPPALEKLKGKGPLPMEAIEKMASLCMRDPDEDEEEGTDEDDLEADDDLLAELNEVLGEEQKASETPPPVAQPKPEAPHPGLETTLQERLALYQTAIESARQAGDSAKMRRYDRGLKTLENLLASIRKGNAIDEADIPPPVAIGKGPASTPTYSPAPTQPAPRIASAPEPRVTLEGPSATAPASSPGLAKPQMPPGPCSPGPLAQLQSRQRDYKLAALHAKQQGDTTAAARHFRVAKSFDAVLEALSRGEPVDLSCLPPPPDQLPPDPPSPPSQPPTPATAPSTTEVPPPPRTLLEA Predict reactive species Full Name: coiled-coil and C2 domain containing 1A Calculated Molecular Weight: 951 aa, 104 kDa Observed Molecular Weight: 130 kDa, 104 kDa GenBank Accession Number: BC064981 Gene Symbol: CC2D1A Gene ID (NCBI): 54862 RRID: AB_2275394 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6P1N0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924