Proteintech, 16900-1-AP, GALNTL2 Polyclonal antibody

Size: 20ul / 150ul The GALNTL2 (16900-1-AP) by Proteintech is a Polyclonal antibody targeting GALNTL2 in WB, IHC, ELISA applications with reactivity to human, mouse samples 16900-1-AP targets GALNTL2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, human liver tissue Positive IHC detected in: mouse small intestine tissue, human kidney tissue, human testis tissue, human placenta tissue, human brain tissue, human lung tissue, human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GALNTL2, also known as GALNT15, is a member of the polypeptide ppGalNAc-T family. It catalyzes the initial step in O-linked oligosaccharide biosynthesis by transferring an N-acetyl-D-galactosamine residue to serine or threonine residues on protein receptors. Though it shows weaker activity compared to GALNT2, it can transfer up to seven GalNAc residues to the Muc5AC peptide, suggesting cooperative action with other GALNT proteins. GALNTL2 is widely expressed, with high expression in tissues like the small intestine, placenta, spleen, cerebral cortex, and ovary. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10434 Product name: Recombinant human GALNTL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 287-639 aa of BC014789 Sequence: ECHPGWLEPLLSRIAGDRSRVVSPVIDVIDWKTFQYYPSKDLQRGVLDWKLDFHWEPLPEHVRKALQSPISPIRSPVVPGEVVAMDRHYFQNTGAYDSLMSLRGGENLELSFKAWLCGGSVEILPCSRVGHIYQNQDSHSPLDQETTLRNRVRIAETWLGSFKETFYKHSPEAFSLSKAEKPDCMERLQLQRRLGCRTFHWFLANVYPELYPSEPRPSFSGKLHNTGLGLCADCQAEGDILGCPMVLAPCSDSRQQQYLQHTSRKEIHFGSPQHLCFAVRQEQVILQNCTEEGLAIHQQHWDFQENGMIVHILSGKCMEAVVQENNKDLYLRPCDGKARQQWRFDQINAVDER Predict reactive species Full Name: UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 2 Calculated Molecular Weight: 639 aa, 73 kDa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC014789 Gene Symbol: GALNTL2 Gene ID (NCBI): 117248 RRID: AB_2263208 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N3T1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.