Product Description
Size: 20ul / 150ul
The NDUFB1 (16902-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFB1 in WB, IHC, ELISA applications with reactivity to human, mouse samples
16902-1-AP targets NDUFB1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: A375 cells, mouse heart tissue, human colon tissue
Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:2400
Immunohistochemistry (IHC): IHC : 1:20-1:200
Specification
Tested Reactivity: human, mouse
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag10443 Product name: Recombinant human NDUFB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-69 aa of BC009691 Sequence: VAVGAEAAAIMVNLLQIVRDHWVHVLVPMGFVIGCYLDRKSDERLTAFRNKSMLFKRELQPSEEVTWK Predict reactive species
Full Name: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 1, 7kDa
Calculated Molecular Weight: 12 kDa, 7 kDa
Observed Molecular Weight: 7 kDa
GenBank Accession Number: BC009691
Gene Symbol: NDUFB1
Gene ID (NCBI): 4707
RRID: AB_2150787
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: O75438
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924