Proteintech, 16906-1-AP, PIGT Polyclonal antibody

Size: 20ul / 150ul The PIGT (16906-1-AP) by Proteintech is a Polyclonal antibody targeting PIGT in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 16906-1-AP targets PIGT in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human brain tissue, A549 cells Positive IP detected in: mouse liver tissue Positive IHC detected in: human brain tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:100-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information PIGT is a subunit of the glycosylphosphatidylinositol transamidase complex that catalyzes the attachment of proteins to GPI-anchors. GPI-anchors are glycolipids found on membrane of diverse cells that help proteins anchoring to the cell surface. Mutations of PIGT have been linked to developmental disorders including multiple congenital anomalies-hypotonia-seizures syndrome-3. Multiple isoforms of PIGT exist due to the alternative splicing, with the predicted MWs ranging from 42 kDa to 66 kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10521 Product name: Recombinant human PIGT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 230-578 aa of BC015022 Sequence: RCTSISWELRQTLSVVFDAFITGQGKKDWSLFRMFSRTLTEPCPLASESRVYVDITTYNQDNETLEVHPPPTTTYQDVILGTRKTYAIYDLLDTAMINNSRNLNIQLKWKRPPENEAPPVPFLHAQRYVSGYGLQKGELSTLLYNTHPYRAFPVLLLDTVPWYLRLYVHTLTITSKGKENKPSYIHYQPAQDRLQPHLLEMLIQLPANSVTKVSIQFERALLKWTEYTPDPNHGFYVSPSVLSALVPSMVAAKPVDWEESPLFNSLFPVSDGSNYFVRLYTEPLLVNLPTPDFSMPYNVICLTCTVVAVCYGSFYNLLTRTFHIEEPRTGGLAKRLANLIRRARGVPPL Predict reactive species Full Name: phosphatidylinositol glycan anchor biosynthesis, class T Calculated Molecular Weight: 578 aa, 66 kDa Observed Molecular Weight: 66 kDa GenBank Accession Number: BC015022 Gene Symbol: PIGT Gene ID (NCBI): 51604 RRID: AB_2164836 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q969N2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.