Proteintech, 16932-1-AP, AP1B1 Polyclonal antibody

Size: 20ul / 150ul The AP1B1 (16932-1-AP) by Proteintech is a Polyclonal antibody targeting AP1B1 in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 16932-1-AP targets AP1B1 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse colon tissue, HEK-293 cells, mouse liver tissue, rat colon tissue, rat liver tissue Positive IP detected in: HEK-293 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information AP1B1 is a subunit of the adaptor complex AP-1 and is a member of the adaptin protein family. Adaptor protein (AP) complexes are cytosolic heterotetramers that mediate the sorting of membrane proteins in the secretory and endocytic pathways. AP-1 is found at the cytoplasmic face of coated vesicles located at the Golgi complex, where it mediates both the recruitment of clathrin to the membrane and the recognition of sorting signals within the cytosolic tails of transmembrane receptors. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10417 Product name: Recombinant human AP1B1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 671-919 aa of BC046242 Sequence: NFVAPPTAAVPANLGAPIGSGLSDLFDLTSGVGTLSGSYVAPKAVGSISMDLQLTNKALQVMTDFAIQFNRNSFGLAPAAPLQVHAPLSPNQTVEISLPLSTVGSVMKMEPLNNLQVAVKNNIDVFYFSTLYPLHILFVEDGKMDRQMFLATWKDIPNENEAQFQIRDCPLNAEAASSKLQSSNIFTVAKRNVEGQDMLYQSLKLTNGIWVLAELRIQPGNPSCTLSLKCRAPEVSQHVYQAYETILKN Predict reactive species Full Name: adaptor-related protein complex 1, beta 1 subunit Calculated Molecular Weight: 919 aa, 101 kDa Observed Molecular Weight: 101 kDa GenBank Accession Number: BC046242 Gene Symbol: AP1B1 Gene ID (NCBI): 162 RRID: AB_2058204 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q10567 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.