Proteintech, 16956-1-AP, ARL6IP6 Polyclonal antibody

Size: 20ul / 150ul The ARL6IP6 (16956-1-AP) by Proteintech is a Polyclonal antibody targeting ARL6IP6 in WB, IHC, ELISA applications with reactivity to human, mouse samples 16956-1-AP targets ARL6IP6 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, human placenta tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10598 Product name: Recombinant human ARL6IP6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-110 aa of BC028741 Sequence: MSFAESGWRSALRRRGPGTPGPVARPSYSSFTQGDSWGEGEVDEEEGCDQVARDLRAEFSAGAWSEPRKRSVLPPDGNGSPVLPDKRNGIFPAAAGSRAQPRRWPVQVLS Predict reactive species Full Name: ADP-ribosylation-like factor 6 interacting protein 6 Calculated Molecular Weight: 226 aa, 25 kDa Observed Molecular Weight: 23-25 kDa GenBank Accession Number: BC028741 Gene Symbol: ARL6IP6 Gene ID (NCBI): 151188 RRID: AB_2058995 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N6S5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.