Iright
BRAND / VENDOR: Proteintech

Proteintech, 16977-1-AP, SGOL1 Polyclonal antibody

CATALOG NUMBER: 16977-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SGOL1 (16977-1-AP) by Proteintech is a Polyclonal antibody targeting SGOL1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 16977-1-AP targets SGOL1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, PC-3 cells, NIH/3T3 cells, mouse heart tissue, rat heart tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information SGOL1 (Shugoshin 1), a centromeric protein, plays an important role in mitosis (PMID: 23102702). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9700 Product name: Recombinant human SGOL1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-292 aa of BC017867 Sequence: MAKERCLKKSFQDSLEDIKKRMKEKRNKNLAEIGKRRSFIAAPCQIITNTSTLLKNYQDNNKMLVLALENEKSKVKEAQDIILQLRKECYYLTCQLYALKGKLTSQQTVEPAQNQEICSSGMDPNSDDSSRNLFVKDLPQIPLEETELPGQGESFQIEATPPETQQSPHLSLKDITNVSLYPVVKIRRLSLSPKKNKASPAVALPKRRCTASVNYKEPTLASKLRRGDPFTDLCFLNSPIFKQKKDLRRSKKRALEVSPAKEAIFILYYVREFVSRFPDCRKCKLETHICLR Predict reactive species Full Name: shugoshin-like 1 (S. pombe) Calculated Molecular Weight: 561aa,64 kDa; 292aa,34 kDa Observed Molecular Weight: 64 kDa GenBank Accession Number: BC017867 Gene Symbol: SGOL1 Gene ID (NCBI): 151648 RRID: AB_2188437 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5FBB7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924