Iright
BRAND / VENDOR: Proteintech

Proteintech, 16990-1-AP, AGBL3 Polyclonal antibody

CATALOG NUMBER: 16990-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The AGBL3 (16990-1-AP) by Proteintech is a Polyclonal antibody targeting AGBL3 in WB, IHC, ELISA applications with reactivity to human, mouse samples 16990-1-AP targets AGBL3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue, L02 cells Positive IHC detected in: human lung cancer tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information AGBL3, also named as CCP3, is a metallocarboxypeptidase that may play a role in the processing of tubulin. AGBL3 has some isoforms with MW 107 kDA, 73 kDa, 116 kDa and 20 kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10592 Product name: Recombinant human AGBL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 272-621 aa of BC030651 Sequence: QDGRHYFSLTWTFQFPHNKDTCYFAHCYPYTYTNLQEYLSGINNDPVRSKFCKIRVLCHTLARNMVYILTITTPLKNSDSRKRKAVILTARVHPGETNSSWIMKGFLDYILGNSSDAQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDLNRNYTSLLKESFPSVWYTRNMVHRLMEKREVILYCDLHGHSRKENIFMYGCDGSDRSKTLYLQQRIFPLMLSKNCPDKFSFSACKFNVQKSKEGTGRVVMWKMGIRNSFTMEATFCGSTLGNKRGTHFSTKDLESMGYHFCDSLLDYCDPDRTKYYRCLKELEEMERHITLEKVFEDSDTPVIDITLDVESRELTFLLR Predict reactive species Full Name: ATP/GTP binding protein-like 3 Calculated Molecular Weight: 73 kDa, 116 kDa Observed Molecular Weight: 73 kDa GenBank Accession Number: BC030651 Gene Symbol: AGBL3 Gene ID (NCBI): 340351 RRID: AB_2878337 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NEM8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924