Proteintech, 16994-1-AP, SCAPER Polyclonal antibody

Size: 20ul / 150ul The SCAPER (16994-1-AP) by Proteintech is a Polyclonal antibody targeting SCAPER in IHC, ELISA applications with reactivity to human, mouse samples 16994-1-AP targets SCAPER in IF, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse testis tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SCAPER, also named as KIAA1454 and ZNF291, is a CCNA2/CDK2 regulatory protein that transiently maintains CCNA2 in the cytoplasm. Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10679 Product name: Recombinant human SCAPER protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-292 aa of BC015212 Sequence: MGLIDKLCACFLSVQGPVDENPKMAIFLQHAAGLLHAMCTLCFAVTGRSYSIFDNNRQDPTGLTAALQATDLAGVLHMLYCVLFHGTILDPSTASPKENYTQNTIQVAIQSLRFFNSFAALHLPAFQSIVGAEGLSLAFRHMASSLLGHCSQVSCESLLHEVIVCVGYFTVNHPDNQVIVQSGRHPTVLQKLCQLPFQYFSDPRLIKVLFPSLIAACYNNHQNKIILEQEMSCVLLATFIQDLAQTPGQAENQPYQPKGKCLGSQDYLELANRFPQQAWEEARQFFLKKEKK Predict reactive species Full Name: S-phase cyclin A-associated protein in the ER Calculated Molecular Weight: 292 aa, 32 kDa GenBank Accession Number: BC015212 Gene Symbol: SCAPER Gene ID (NCBI): 49855 RRID: AB_2878339 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BY12 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.