Proteintech, 17006-1-AP, MRPS15 Polyclonal antibody

Size: 20ul / 150ul The MRPS15 (17006-1-AP) by Proteintech is a Polyclonal antibody targeting MRPS15 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 17006-1-AP targets MRPS15 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse liver tissue, MCF-7 cells, Raji cells Positive IP detected in: mouse brain tissue Positive IHC detected in: human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information MRPS15, also named as RPMS15 or DC37, is a 257 amino acid protein, which belongs to the ribosomal protein S15P family. MRPS15 localizes in the Mitochondrion and is a component of the mitochondrial ribosome small subunit (28S) which comprises a 12S rRNA and about 30 distinct proteins. MRPS15 is involved into the mitochondrial proteins biosynthesis and ribosomal biogenesis. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10702 Product name: Recombinant human MRPS15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-257 aa of BC031336 Sequence: MLRVAWRTLSLIRTRAVTQVLVPGLPGGGSAKFPFNQWGLQPRSLLLQAARGYVVRKPAQSRLDDDPPPSTLLKDYQNVPGIEKVDDVVKRLLSLEMANKKEMLKIKQEQFMKKIVANPEDTRSLEARIIALSVKIRSYEEHLEKHRKDKAHKRYLLMSIDQRKKMLKNLRNTNYDVFEKICWGLGIEYTFPPLYYRRAHRRFVTKKALCIRVFQETQKLKKRRRALKAAAAAQKQAKRRNPDSPAKAIPKTLKDSQ Predict reactive species Full Name: mitochondrial ribosomal protein S15 Calculated Molecular Weight: 257 aa, 30 kDa Observed Molecular Weight: 25-30 kDa GenBank Accession Number: BC031336 Gene Symbol: MRPS15 Gene ID (NCBI): 64960 RRID: AB_2301068 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P82914 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.