Iright
BRAND / VENDOR: Proteintech

Proteintech, 17017-1-AP, ADPRM Polyclonal antibody

CATALOG NUMBER: 17017-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ADPRM (17017-1-AP) by Proteintech is a Polyclonal antibody targeting ADPRM in WB, ELISA applications with reactivity to human, mouse, rat, pig samples 17017-1-AP targets ADPRM in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue, pig brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information ADPRM (ADP-ribose/CDP-alcohol diphosphatase, manganese dependent) is a manganese-dependent glycophosphatase primarily responsible for the breakdown of molecules such as ADP-ribose, IDP-ribose, CDP-glycerol, CDP-choline and CDP-ethanolamine in the cell. The protein is predicted to be located in the cytoplasm and possesses 2',3'-cyclic nucleotide 2'-phosphodiesterase activity, manganese ion-binding activity, and pyrophosphatase activity. ADPRM plays an important role in embryonic development, particularly in the formation of the heart and lungs. In addition, ADPRM may be involved in immune cell signaling, acting as a second messenger for ADP-ribose to activate TRPM2, which in turn regulates oxidative/nitrosative stress. Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9997 Product name: Recombinant human C17orf48 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-205 aa of BC001294 Sequence: MDDKPNPEALSDSSERLFSFGVIADVQFADLEDGFNFQGTRRRYYRHSLLHLQGAIEDWNNESSMPCCVLQLGDIIDGYNAQYNASKKSLELVMDMFKRLKVPVHHTWGNHEFYNFSREYLTHSKLNTKFLEDQIVHHPETMPSEDYYAYHFVPFPKFRFILLDAYDLSVLGVDQSSPKYEQCMKILREHNPNTELNSPQGELFL Predict reactive species Full Name: chromosome 17 open reading frame 48 Calculated Molecular Weight: 40 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC001294 Gene Symbol: C17orf48 Gene ID (NCBI): 56985 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q3LIE5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924