Proteintech, 17020-1-AP, PPM1F Polyclonal antibody

Size: 20ul / 150ul The PPM1F (17020-1-AP) by Proteintech is a Polyclonal antibody targeting PPM1F in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 17020-1-AP targets PPM1F in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, L02 cells, HepG2 cells, human liver tissue, K-562 cells, HeLa cells Positive IP detected in: MCF-7 cells Positive IHC detected in: human ovary cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Mg2+/Mn2+-dependent protein phosphatase 1F (PPM1F) belongs to the PP2C family of Ser/Thr protein phosphatases and is the critical enzyme responsible for dephosphorylating the threonine motif. PPM1F is ubiquitous in various tissues and organs (PMID: 26498692). High expression of PPM1F was positively associated with poor survival and tumor recurrence in patients with cancers and PPM1F might be a potential biomarker in HCC patients (PMID: 30470261). Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10186 Product name: Recombinant human PPM1F protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 104-453 aa of BC071989 Sequence: EEEEDDDEEKAPVTLLDAQSLAQSFFNRLWEVAGQWQKQVPLAARASQRQWLVSIHAIRNTRRKMEDRHVSLPSFNQLFGLSDPVNRAYFAVFDGHGGVDAARYAAVHVHTNAARQPELPTDPEGALREAFRRTDQMFLRKAKRERLQSGTTGVCALIAGATLHVAWLGDSQVILVQQGQVVKLMEPHRPERQDEKARIEALGGFVSHMDCWRVNGTLAVSRAIGDVFQKPYVSGEADAASRALTGSEDYLLLACDGFFDVVPHQEVVGLVQSHLTRQQGSGLRVAEELVAAARERGSHDNITVMVVFLRDPQELLEGGNQGEGDPQAEGRRQDLPSSLPEPETQAPPRS Predict reactive species Full Name: protein phosphatase 1F (PP2C domain containing) Calculated Molecular Weight: 453 aa, 50 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC071989 Gene Symbol: PPM1F Gene ID (NCBI): 9647 RRID: AB_2284338 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P49593 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.