Proteintech, 17047-1-AP, ROGDI Polyclonal antibody

Size: 20ul / 150ul The ROGDI (17047-1-AP) by Proteintech is a Polyclonal antibody targeting ROGDI in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples 17047-1-AP targets ROGDI in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human brain tissue, human kidney tissue, mouse brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human kidney tissue, human placenta tissue, human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information ROGDI encoded by the ROGDI gene, which encodes a leucine-zipper protein with high expression in the human spinal cord and brain, acts as a positive regulator of cell proliferation. Defections of ROGDI are the cause of Kohlschuetter-Toenz syndrome (KTZS) Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, drosophila Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10688 Product name: Recombinant human ROGDI protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-287 aa of BC012901 Sequence: MATVMAATAAERAVLEEEFRWLLHDEVHAVLKQLQDILKEASLRFTLPGSGTEGPAKQENFILGSCGTDQVKGVLTLQGDALSQADVNLKMPRNNQLLHFAFREDKQWKLQQIQDARNHVSQAIYLLTSRDQSYQFKTGAEVLKLMDAVMLQLTRARNRLTTPATLTLPEIAASGLTRMFAPALPSDLLVNVYINLNKLCLTVYQLHALQPNSTKNFRPAGGAVLHSPGAMFEWGSQRLEVSHVHKVECVIPWLNDALVYFTVSLQLCQQLKDKISVFSSYWSYRPF Predict reactive species Full Name: rogdi homolog (Drosophila) Calculated Molecular Weight: 287 aa, 32 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC012901 Gene Symbol: ROGDI Gene ID (NCBI): 79641 RRID: AB_2182328 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9GZN7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.