Iright
BRAND / VENDOR: Proteintech

Proteintech, 17048-1-AP, STARD10 Polyclonal antibody

CATALOG NUMBER: 17048-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The STARD10 (17048-1-AP) by Proteintech is a Polyclonal antibody targeting STARD10 in WB, IP, IHC, ELISA applications with reactivity to human samples 17048-1-AP targets STARD10 in WB, IP, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, T-47D cells Positive IP detected in: HepG2 cells Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information STARD10 (START domain-containing protein 10, also known as PCTP-like protein) is highly expressed in liver and responsible to transfer phosphatidylcholine. STARD10 was identified as a protein overexpressed in breast cancer that cooperates with the ErbB family of receptor tyrosine kinases in cellular transformation (PMID: 15911624). This antibody detected duplicate bands between 35-40 kDa (PMID: 15150109). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10705 Product name: Recombinant human STARD10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-291 aa of BC007919 Sequence: MEKLAASTEPQGPRPVLGRESVQVPDDQDFRSFRSECEAEVGWNLTYSRAGVSVWVQAVEMDRTLHKIKCRMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACLKYPEWKQKHLPHFKPWLHPEQSPLPSLALSELSVQHADSLENIDESAVAESREERMGGAGGEGSDDDTSLT Predict reactive species Full Name: StAR-related lipid transfer (START) domain containing 10 Calculated Molecular Weight: 291 aa, 33 kDa Observed Molecular Weight: 35-40 kDa GenBank Accession Number: BC007919 Gene Symbol: STARD10 Gene ID (NCBI): 10809 RRID: AB_2255485 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y365 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924