Iright
BRAND / VENDOR: Proteintech

Proteintech, 17078-1-AP, TBC1D5 Polyclonal antibody

CATALOG NUMBER: 17078-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TBC1D5 (17078-1-AP) by Proteintech is a Polyclonal antibody targeting TBC1D5 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 17078-1-AP targets TBC1D5 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A431 cells, HEK-293T cells, Jurkat cells, PC-3 cells Positive IP detected in: Jurkat cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information TBC1D5, a member of TBC (Tre2/Bub2/Cdc16)1 domain family, is a novel retromer-interacting protein. TBC1D5 is a Rab GTPase-activating proteins (GAPs) proteins that negatively regulates VPS35/29/26 recruitment and causes Rab7 to dissociate from the membrane. TBC1D5 could bridge the endosome and autophagosome via its C-terminal LIR motif, and Rab GAPs are implicated in the reprogramming of the endocytic trafficking events under starvation-induced autophagy. The TBC1D5 protein exists 89 kDa and 91 kDa isoforms. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10991 Product name: Recombinant human TBC1D5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 445-795 aa of BC013145 Sequence: TNAKGAPLNINKVSNSLINFGRKLISPAMAPGSAGGPVPGGNSSSSSSVVIPTRTSAEAPSHHLQQQQQQQRLMKSESMPVQLNKGLSSKNISSSPSVESLPGGREFTGSPPSSATKKDSFFSNISRSRSHSKTMGRKESEEELEAQISFLQGQLNDLDAMCKYCAKVMDTHLVNIQDVILQENLEKEDQILVSLAGLKQIKDILKGSLRFNQSQLEAEENEQITIADNHYCSSGQGQGRGQGQSVQMSGAIKQASSETPGCTDRGNSDDFILISKDDDGSSARGSFSGQAQPLRTLRSTSGKSQAPVCSPLVFSDPLMGPASASSSNPSSSPDDDSSKDSGFTIVSPLDI Predict reactive species Full Name: TBC1 domain family, member 5 Calculated Molecular Weight: 795 aa, 89 kDa Observed Molecular Weight: 89 kDa GenBank Accession Number: BC013145 Gene Symbol: TBC1D5 Gene ID (NCBI): 9779 RRID: AB_2199389 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92609 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924