Iright
BRAND / VENDOR: Proteintech

Proteintech, 17132-1-AP, PNAD Polyclonal antibody

CATALOG NUMBER: 17132-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PNAD (17132-1-AP) by Proteintech is a Polyclonal antibody targeting PNAD in WB, ELISA applications with reactivity to human samples 17132-1-AP targets PNAD in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, Jurkat cells, L02 cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information PNAD is an N-terminal aspartic acid deamidation enzyme, which can deamidate N-terminal aspartic acid residues to aspartic acid, making the protein prone to arginination, polyubiquitination and degradation. In addition, PNAD is involved in the regulation of apoptosis by mediating the degradation of the C-terminal fragment of Drosophila apoptosis suppressor protein 1. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10880 Product name: Recombinant human NTAN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-310 aa of BC017336 Sequence: MPLLVEGRRVRLPQSAGDLVRAHPPLEERARLLRGQSVQQVGPQGLLYVQQRELAVTSPKDGSISILGSDDATTCHIVVLRHTGNGATCLTHCDGTDTKAEVPLIMNSIKSFSDHAQCGRLEVHLVGGFSDDRQLSQKLTHQLLSEFDRQEDDIHLVTLCVTELNDREENENHFPVIYGIAVNIKTAEIYRASFQDRGPEEQLRAARTLAGGPMISIYDAETEQLRIGPYSWTPFPHVDFWLHQDDKQILENLSTSPLAEPPHFVEHIRSTLMFLKKHPSPAHTLFSGNKALLYKKNEDGLWEKISSPGS Predict reactive species Full Name: N-terminal asparagine amidase Calculated Molecular Weight: 310 aa, 35 kDa Observed Molecular Weight: 30-35 kDa GenBank Accession Number: BC017336 Gene Symbol: NTAN1 Gene ID (NCBI): 123803 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96AB6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924