Iright
BRAND / VENDOR: Proteintech

Proteintech, 17134-1-AP, PDHA2/PDHA1 Polyclonal antibody

CATALOG NUMBER: 17134-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PDHA2/PDHA1 (17134-1-AP) by Proteintech is a Polyclonal antibody targeting PDHA2/PDHA1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 17134-1-AP targets PDHA2/PDHA1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, human placenta tissue, mouse testis tissue, rat testis tissue Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PDHA2 (Pyruvate Dehydrogenase E1 Subunit Alpha 2) is a testis-specific mitochondrial enzyme encoded by the PDHA2 gene on human chromosome 4q22.3. The gene exhibits 84% nucleotide sequence similarity with the X-linked PDHA1, supporting the hypothesis that PDHA2 originated through retrotransposition of PDHA1 to an autosomal location. This antibody can recognize both PDHA2 and PDHA1. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10882 Product name: Recombinant human PDHA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-388 aa of BC030697 Sequence: MLAAFISRVLRRVAQKSARRVLVASRNSSNDATFEIKKCDLYLLEEGPPVTTVLTRAEGLKYYRMMLTVRRMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGINPSDHVITSYRAHGVCYTRGLSVRSILAELTGRRGGCAKGKGGSMHMYTKNFYGGNGIVGAQGPLGAGIALACKYKGNDEICLTLYGDGAANQGQIAEAFNMAALWKLPCVFICENNLYGMGTSTERAAASPDYYKRGNFIPGLKVDGMDVLCVREATKFAANYCRSGKGPILMELQTYRYHGHSMSDPGVSYRTREEIQEVRSKRDPIIILQDRMVNSKLATVEELKEIGAEVRKEIDDAAQFATTDPEPHLEELGHHIYSSDSSFEVRGANPWIKFKSVS Predict reactive species Full Name: pyruvate dehydrogenase (lipoamide) alpha 2 Calculated Molecular Weight: 388 aa, 43 kDa Observed Molecular Weight: 40-43 kDa GenBank Accession Number: BC030697 Gene Symbol: PDHA2 Gene ID (NCBI): 5161 RRID: AB_2878352 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P29803 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924